PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015894278.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 192aa    MW: 21894.4 Da    PI: 9.8694
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015894278.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.7e-33113171159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+
  XP_015894278.1 113 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGMHSHP 171
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-3498171IPR003657WRKY domain
SuperFamilySSF1182901.05E-29105172IPR003657WRKY domain
PROSITE profilePS5081130.125108173IPR003657WRKY domain
SMARTSM007741.1E-38113172IPR003657WRKY domain
PfamPF031061.5E-26114171IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MENYQPFFPF QSSSSPSSSL SLNMVNINPH ADNTHEHQYH QVSGNNKSNG FLGLMSEMEV  60
SGTTTTTTTT ANTKTVSHSS ENDLKLAGGK KKGEKKVRKP RYAFQTRSQV DILDDGYRWR  120
KYGQKAVKNN KFPRSYYRCT HQGCNVKKQV QRLTKDEGVV VTTYEGMHSH PIEKSTDNFE  180
HILSQMQIYT TF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-28103172776Probable WRKY transcription factor 4
2lex_A4e-28103172776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015894278.11e-144PREDICTED: probable WRKY transcription factor 75
TrEMBLC7S8119e-90C7S811_FRAAN; WRKY DNA binding protein
STRINGPOPTR_0003s16750.19e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-60WRKY DNA-binding protein 75